PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_06398.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARF
Protein Properties Length: 864aa    MW: 96107 Da    PI: 6.9769
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_06398.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.89.9e-24146247199
                              EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EE CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfv 80 
                              f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD +
  Sme2.5_06398.1_g00002.1 146 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAF 230
                              99*****************************7333.34459********************************************* PP

                              EEEE-SSSEE..EEEEE-S CS
                       B3  81 vFkldgrsefelvvkvfrk 99 
                              +F   + +++el+v+v+r+
  Sme2.5_06398.1_g00002.1 231 IFL--RGENGELRVGVRRA 247
                              ***..449999*****996 PP

2Auxin_resp79.58.1e-27272332161
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsG 61 
                              a+ha++tk++F+v+Y+Pr+s++eF+++++++++++k+++s+GmRfkm+fe+e+++e+r+++
  Sme2.5_06398.1_g00002.1 272 AWHAIQTKTMFTVYYKPRTSPAEFIIPYDHYMESVKNNYSIGMRFKMRFEGEEAPEQRYAA 332
                              89********************************************************865 PP

3Auxin_resp26.13.7e-103443705783
               Auxin_resp  57 rrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              ++++Gt+vg++d+dp rW +SkWr+Lk
  Sme2.5_06398.1_g00002.1 344 KSFTGTIVGIEDTDPQRWLDSKWRCLK 370
                              689**********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.22E-40142275IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.1E-41142261IPR015300DNA-binding pseudobarrel domain
CDDcd100177.97E-22144246No hitNo description
PROSITE profilePS5086312.012146248IPR003340B3 DNA binding domain
PfamPF023621.2E-21146247IPR003340B3 DNA binding domain
SMARTSM010192.0E-23146248IPR003340B3 DNA binding domain
PfamPF065073.3E-29272370IPR010525Auxin response factor
PfamPF023094.5E-10734823IPR033389AUX/IAA domain
SuperFamilySSF542773.38E-12734815No hitNo description
PROSITE profilePS5174523.891738822IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 864 aa     Download sequence    Send to blast
MAASEVSIKG YSEPSDGSRT VSETVWSTSG VGKVDADTAL YTELWRSCAG PLVTVPREGE  60
LVYYFPQGHI EQVEASTNQV ADQQMPLYNL PSKILCRVAN VLLKAEPDTD EVYAQVTLMP  120
EPNQDANAVK KEPMRPPPPR FHVHSFCKTL TASDTSTHGG FSVLRRHADE CLPPLDMSRQ  180
PPTQELVAKD LHGNEWRFRH IFRGQPRRHL LQSGWSVFVS SKRLVAGDAF IFLRGENGEL  240
RVGVRRAMRQ QGNAPSSVIS SHSMHLGVLA TAWHAIQTKT MFTVYYKPRT SPAEFIIPYD  300
HYMESVKNNY SIGMRFKMRF EGEEAPEQRY AAVYFVEVIS LLFKSFTGTI VGIEDTDPQR  360
WLDSKWRCLK VRWDENSSIP RPDRVSPWKI EPALSPPALN APPVARTKRP RSNILPSSPD  420
SSVLTREGSS RVTADHSQAS GFSRVLQGQE LTTSRGGFAE SNETDLSEKP MLWQPSVNDE  480
KNDNYSASKR HHSGKWLPLG RPESSLTDLL SGFGVPNNSS LGFCLPSADQ AAFGASLVKQ  540
QTQDQEKDFS LLGKPWSLSP SSLSLNLMDS GSKAPGLRGE TPYQMRGDAR YSAFGEFSVL  600
PGHRLANQQG SWVPQPVSPY MKLSHSREMM HKPTVVKQPE AVKPKEGNCK LFGIPLTSSV  660
CTDPVMMQKS SLHDPVSDKN FGIHPHQSPA TDSDQRAEQS KGSKVDDGIA ANDHDKQFQT  720
FHLAGRERDG KGHSSSTRSC TKVHKQGTAL GRSVDLAKFN NYDELIAELD GLFDFNGELK  780
ARSKSWLVVY TDDEGDMMLV GDDPWQEFCG MVRKIFIYTK EEVQRMNPGT LNSKGEDTSS  840
VAEGSDAKEV KNQLLPSESC QEEY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1703239212354Auxin response factor 1
4ldw_A1e-1703239212354Auxin response factor 1
4ldw_B1e-1703239212354Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3402550.0DQ340255.1 Lycopersicon esculentum auxin response factor 2 (ARF2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006341482.10.0PREDICTED: auxin response factor 2-like
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLM1B4690.0M1B469_SOLTU; Auxin response factor
STRINGPGSC0003DMT4000367650.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26182444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2